GET /api/protein/UniProt/A0A8C6QM37/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C6QM37",
"id": "A0A8C6QM37_NANGA",
"source_organism": {
"taxId": "1026970",
"scientificName": "Nannospalax galili",
"fullName": "Nannospalax galili (Northern Israeli blind subterranean mole rat)"
},
"name": "Protein preY, mitochondrial",
"description": [
"In mitochondria, S-adenosylmethionine-dependent methyltransferase chaperone that supports both coenzyme Q biosynthesis, by stabilizing its components, such as COQ5, and NADH:ubiquinone oxidoreductase complex (complex I, MT-ND1) assembly, by stabilizing complex I assembly factors, such as NDUFAF5"
],
"length": 113,
"sequence": "MLSAVCSRLAWAPRAPRTVWALTRRCLQAPGPRSCAKQSERAEEPPRTFHPSLLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAARTMHQKKKQEEVEQH",
"proteome": "UP000694381",
"gene": "Pyurf",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2861fde0ae1f0066f39d64a8f970a50f99293bcc",
"counters": {
"domain_architectures": 17978,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"cathgene3d": 1,
"panther": 1,
"hamap": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17978
}
}
}