General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C6QM37",
        "id": "A0A8C6QM37_NANGA",
        "source_organism": {
            "taxId": "1026970",
            "scientificName": "Nannospalax galili",
            "fullName": "Nannospalax galili (Northern Israeli blind subterranean mole rat)"
        },
        "name": "Protein preY, mitochondrial",
        "description": [
            "In mitochondria, S-adenosylmethionine-dependent methyltransferase chaperone that supports both coenzyme Q biosynthesis, by stabilizing its components, such as COQ5, and NADH:ubiquinone oxidoreductase complex (complex I, MT-ND1) assembly, by stabilizing complex I assembly factors, such as NDUFAF5"
        ],
        "length": 113,
        "sequence": "MLSAVCSRLAWAPRAPRTVWALTRRCLQAPGPRSCAKQSERAEEPPRTFHPSLLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAARTMHQKKKQEEVEQH",
        "proteome": "UP000694381",
        "gene": "Pyurf",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2861fde0ae1f0066f39d64a8f970a50f99293bcc",
        "counters": {
            "domain_architectures": 17978,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17978
        }
    }
}