General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C6NNE7",
        "id": "A0A8C6NNE7_NOTFU",
        "source_organism": {
            "taxId": "105023",
            "scientificName": "Nothobranchius furzeri",
            "fullName": "Nothobranchius furzeri (Turquoise killifish)"
        },
        "name": "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial",
        "description": [
            "Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q)",
            "Iron-sulfur protein (IP) subunit of the succinate dehydrogenase complex (mitochondrial respiratory chain complex II), responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). SDH also oxidizes malate to the non-canonical enol form of oxaloacetate, enol-oxaloacetate. Enol-oxaloacetate, which is a potent inhibitor of the succinate dehydrogenase activity, is further isomerized into keto-oxaloacetate"
        ],
        "length": 280,
        "sequence": "MSVASFTSLSRCGVMAFRSPAVRYAQTAAAPSVQPRIKKFQIYRWDPDTPGDKPRMQTYEVDLNACGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACLNKIDANLSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKNDESKEGKEQYLQSVEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWLIDSRDDFTEQRLSKLQDPFSLFRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKKAAPTN",
        "proteome": "UP000694548",
        "gene": "SDHB",
        "go_terms": [
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006099",
                "name": "tricarboxylic acid cycle",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0051537",
                "name": "2 iron, 2 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e3c13263eee326ff8609d36a527989825e0a205f",
        "counters": {
            "domain_architectures": 12687,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "profile": 2,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 2,
                "prosite": 2,
                "interpro": 10
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12687
        }
    }
}