General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C6N6G5",
        "id": "A0A8C6N6G5_MELUD",
        "source_organism": {
            "taxId": "13146",
            "scientificName": "Melopsittacus undulatus",
            "fullName": "Melopsittacus undulatus (Budgerigar)"
        },
        "name": "Neutrophil cytosol factor 4",
        "description": [
            "Subunit of the phagocyte NADPH oxidase complex that mediates the transfer of electrons from cytosolic NADPH to O2 to produce the superoxide anion (O2(-)). In the activated complex, electrons are first transferred from NADPH to flavin adenine dinucleotide (FAD) and subsequently transferred via two heme molecules to molecular oxygen, producing superoxide through an outer-sphere reaction. Activation of the NADPH oxidase complex is initiated by the assembly of cytosolic subunits of the NADPH oxidase complex with the core NADPH oxidase complex to form a complex at the plasma membrane or phagosomal membrane. This activation process is initiated by phosphorylation dependent binding of the cytosolic NCF1/p47-phox subunit to the C-terminus of CYBA/p22-phox"
        ],
        "length": 350,
        "sequence": "MSLPRQLREKSDFDQLPDDVPVSANIADIEEKKGFSNYYLFVIEVKVKGGGRYLIFRRYRQFYALHTKLEEKYGAESKNSPFTCTLPILPGKVYVGAKKEIAENRIPILNAYMKNLLCLPVWVLMDEEVRLFFYHSTFDSEQVPHRLRRLRPRTRRIKSVSPQVPIFDRMAAPRAEALFDFSGTSKLELSFKKGDLIYLLSRVNKDWLEGTAGDATGIFPRAFVKIIKDLPQQEDTVNKIRCYYHDETMSTIRDISVEEDLSSIPSFRDLMELMRQEFDRDDIVLNYRDLDGDLIRLLSDQDIELMVSQSRSRPSEKHFFPWKLHITHKDDLGVYNTSPEIGTTQIVRET",
        "proteome": "UP000694405",
        "gene": "LOC101874702",
        "go_terms": [
            {
                "identifier": "GO:0035091",
                "name": "phosphatidylinositol binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016176",
                "name": "superoxide-generating NADPH oxidase activator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006909",
                "name": "phagocytosis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045730",
                "name": "respiratory burst",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043020",
                "name": "NADPH oxidase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "de90e6682d0785a1fdc39e28cacf8ba89ee33dba",
        "counters": {
            "domain_architectures": 163,
            "entries": 32,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "smart": 3,
                "profile": 3,
                "cdd": 3,
                "pfam": 3,
                "panther": 1,
                "prints": 2,
                "interpro": 11
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 163
        }
    }
}