HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C6N6G5",
"id": "A0A8C6N6G5_MELUD",
"source_organism": {
"taxId": "13146",
"scientificName": "Melopsittacus undulatus",
"fullName": "Melopsittacus undulatus (Budgerigar)"
},
"name": "Neutrophil cytosol factor 4",
"description": [
"Subunit of the phagocyte NADPH oxidase complex that mediates the transfer of electrons from cytosolic NADPH to O2 to produce the superoxide anion (O2(-)). In the activated complex, electrons are first transferred from NADPH to flavin adenine dinucleotide (FAD) and subsequently transferred via two heme molecules to molecular oxygen, producing superoxide through an outer-sphere reaction. Activation of the NADPH oxidase complex is initiated by the assembly of cytosolic subunits of the NADPH oxidase complex with the core NADPH oxidase complex to form a complex at the plasma membrane or phagosomal membrane. This activation process is initiated by phosphorylation dependent binding of the cytosolic NCF1/p47-phox subunit to the C-terminus of CYBA/p22-phox"
],
"length": 350,
"sequence": "MSLPRQLREKSDFDQLPDDVPVSANIADIEEKKGFSNYYLFVIEVKVKGGGRYLIFRRYRQFYALHTKLEEKYGAESKNSPFTCTLPILPGKVYVGAKKEIAENRIPILNAYMKNLLCLPVWVLMDEEVRLFFYHSTFDSEQVPHRLRRLRPRTRRIKSVSPQVPIFDRMAAPRAEALFDFSGTSKLELSFKKGDLIYLLSRVNKDWLEGTAGDATGIFPRAFVKIIKDLPQQEDTVNKIRCYYHDETMSTIRDISVEEDLSSIPSFRDLMELMRQEFDRDDIVLNYRDLDGDLIRLLSDQDIELMVSQSRSRPSEKHFFPWKLHITHKDDLGVYNTSPEIGTTQIVRET",
"proteome": "UP000694405",
"gene": "LOC101874702",
"go_terms": [
{
"identifier": "GO:0035091",
"name": "phosphatidylinositol binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016176",
"name": "superoxide-generating NADPH oxidase activator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006909",
"name": "phagocytosis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045730",
"name": "respiratory burst",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0043020",
"name": "NADPH oxidase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "de90e6682d0785a1fdc39e28cacf8ba89ee33dba",
"counters": {
"domain_architectures": 163,
"entries": 32,
"isoforms": 0,
"proteomes": 1,
"sets": 5,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"smart": 3,
"profile": 3,
"cdd": 3,
"pfam": 3,
"panther": 1,
"prints": 2,
"interpro": 11
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 163
}
}
}