General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C6JKX9",
        "id": "A0A8C6JKX9_MELUD",
        "source_organism": {
            "taxId": "13146",
            "scientificName": "Melopsittacus undulatus",
            "fullName": "Melopsittacus undulatus (Budgerigar)"
        },
        "name": "Elongation factor 1-beta",
        "description": [
            "Catalytic subunit of the guanine nucleotide exchange factor (GEF) (eEF1B subcomplex) of the eukaryotic elongation factor 1 complex (eEF1). Stimulates the exchange of GDP for GTP on elongation factor 1A (eEF1A), probably by displacing GDP from the nucleotide binding pocket in eEF1A"
        ],
        "length": 224,
        "sequence": "MGFGDLKSAAGLRVLNDFLADRSYIEGYVPSQADIAVFEAISAPPPADLFHALRWYNHIKSYEKQKASLPGVKKALGKYGPADVEDTTGAATDSKDDDDIDLFGSDDEEESEEAKKLREERLAQYESKKSKKPAVVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEERITAFEDYVQSMDVAAFNKI",
        "proteome": "UP000694405",
        "gene": "LOC101868021",
        "go_terms": [
            {
                "identifier": "GO:0003746",
                "name": "translation elongation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006414",
                "name": "translational elongation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005853",
                "name": "eukaryotic translation elongation factor 1 complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "17daa7bf5e8e9adbac4b5571e7583d66c6d60aa5",
        "counters": {
            "domain_architectures": 6045,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 2,
                "cathgene3d": 2,
                "ssf": 2,
                "smart": 2,
                "pfam": 2,
                "panther": 1,
                "prosite": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6045
        }
    }
}