General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C6EUH2",
        "id": "A0A8C6EUH2_MARMA",
        "source_organism": {
            "taxId": "9994",
            "scientificName": "Marmota marmota marmota",
            "fullName": "Marmota marmota marmota (Alpine marmot)"
        },
        "name": "Protein NDRG2",
        "description": [
            "Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation",
            "Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes. May be involved in neuron differentiation"
        ],
        "length": 357,
        "sequence": "MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVCGTPKPKRPAIFTYHDVGLNYKSCFQPLFQFGDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLENIELYWNSYNNRRDLNFERGSEITLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASIDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC",
        "proteome": "UP000694407",
        "gene": "NDRG2",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f841d744e16abdae04e268ac06def5af67c5391f",
        "counters": {
            "domain_architectures": 12425,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12425
        }
    }
}