GET /api/protein/UniProt/A0A8C6AAB6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C6AAB6",
"id": "A0A8C6AAB6_MARMA",
"source_organism": {
"taxId": "9994",
"scientificName": "Marmota marmota marmota",
"fullName": "Marmota marmota marmota (Alpine marmot)"
},
"name": "Solute carrier family 25 member 28",
"description": [
"Mitochondrial iron transporter that mediates iron uptake. Probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells"
],
"length": 356,
"sequence": "GAFTNGWLGGVSAGQAGSALLDGWLQRGVGRGAGGGEAGACRPPVRQDPDSGPDYEALPAGATVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALRRIIRTEGLWRPMRGLNVTATGAGPAHALYFACYEKLKKTLSDIIHPGGNSHIANGAAGCVATLLHDAAMNPVEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLAMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLNTQESLALNSNITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEWRAGK",
"proteome": "UP000694407",
"gene": "SLC25A28",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
"counters": {
"domain_architectures": 140476,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140476
}
}
}