HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C5ZXE2",
"id": "A0A8C5ZXE2_MARMA",
"source_organism": {
"taxId": "9994",
"scientificName": "Marmota marmota marmota",
"fullName": "Marmota marmota marmota (Alpine marmot)"
},
"name": "GATOR2 complex protein WDR24",
"description": [
"Catalytic component of the GATOR2 complex, a multiprotein complex that acts as an activator of the amino acid-sensing branch of the mTORC1 signaling pathway. The GATOR2 complex indirectly activates mTORC1 through the inhibition of the GATOR1 subcomplex. GATOR2 probably acts as an E3 ubiquitin-protein ligase toward GATOR1. In the presence of abundant amino acids, the GATOR2 complex mediates ubiquitination of the NPRL2 core component of the GATOR1 complex, leading to GATOR1 inactivation. In the absence of amino acids, GATOR2 is inhibited, activating the GATOR1 complex. In addition to its role in regulation of the mTORC1 complex, promotes the acidification of lysosomes and facilitates autophagic flux. Within the GATOR2 complex, WDR24 constitutes the catalytic subunit that mediates 'Lys-6'-linked ubiquitination of NPRL2"
],
"length": 789,
"sequence": "MEKMSRVTTALGGSALTGRTMNCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVSTFSGQSESVRDVQFSIRDYFTFASTFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDRGWLATGGRDKMVKVWDMTTPRAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPAAMFEEHRDVTTGIAWRHPHDPCFLLSGSKDSTLCQHLFRDASQPVERANPEGLCYGLFGDVAFAAKESLVAAESGRKPYAGDRRHPIFFKRKLDPAEPFSGLASSALSVFETESGGGSMSWFVDTAERYALAGRPLAELCDHNAKVARELGRNQVAQTWTMLRIIYCSPGLVPSASLNHSVGKGSSCGLPLMNSFNLKDMAPGLGSETRLDRSKGDTRSDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYPLDPEHVHPEEPEYVLPQEAFPLRHEILDTPSGPEHLQDKADSPHVSGSEADAASLAPVDSFSLLSISHALYDSRLPTDFFSVLVCDMLRFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCSNCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS",
"proteome": "UP000694407",
"gene": "WDR24",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0032008",
"name": "positive regulation of TOR signaling",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b87005c030e45aa06cdffc5617eb9057c0a981a2",
"counters": {
"domain_architectures": 68956,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"profile": 2,
"cdd": 1,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 68956
}
}
}