GET /api/protein/UniProt/A0A8C5Z3J6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C5Z3J6",
        "id": "A0A8C5Z3J6_MARMA",
        "source_organism": {
            "taxId": "9994",
            "scientificName": "Marmota marmota marmota",
            "fullName": "Marmota marmota marmota (Alpine marmot)"
        },
        "name": "Clathrin light chain",
        "description": [
            "Clathrin is the major protein of the polyhedral coat of coated pits and vesicles"
        ],
        "length": 218,
        "sequence": "MAELDPFGAPAGAPGGPALGNGVAGSGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQETNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH",
        "proteome": "UP000694407",
        "gene": "CLTA",
        "go_terms": [
            {
                "identifier": "GO:0005198",
                "name": "structural molecule activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006886",
                "name": "intracellular protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016192",
                "name": "vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030130",
                "name": "clathrin coat of trans-Golgi network vesicle",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0030132",
                "name": "clathrin coat of coated pit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "960526fd73330e09229907c2c6c9c2da971c1b16",
        "counters": {
            "domain_architectures": 7600,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7600
        }
    }
}