General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C5YY29",
        "id": "A0A8C5YY29_MARMA",
        "source_organism": {
            "taxId": "9994",
            "scientificName": "Marmota marmota marmota",
            "fullName": "Marmota marmota marmota (Alpine marmot)"
        },
        "name": "TIMELESS-interacting protein",
        "description": [
            "Plays an important role in the control of DNA replication and the maintenance of replication fork stability"
        ],
        "length": 285,
        "sequence": "MLEPQENGLVDLPDYEHVEDETFPPFPPPASPQRDGEGAEYDEGSGTRAPVPVPVKRTVKRNIPKLDAQRLISERGLPALRHVFDKTKFKGKGHEAEDLKTLIRNMEHWAHRLFPKLQFEDFIDRVEYLGNKKEVQTCLKRIRLDLPILHEDFVSNDDEVGESKGLDVTAAELDPFLTDSSESEKFASELSRNLTEEQQQRIERNKQLALERRQAKLLSNSQSLGNDMLMNTPKAQTVEEICIDEDQNEESNGLNKDILVSSHNDASVNEEEQLKLEETQLDQSF",
        "proteome": "UP000694407",
        "gene": "TIPIN",
        "go_terms": [
            {
                "identifier": "GO:0000076",
                "name": "DNA replication checkpoint signaling",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006974",
                "name": "DNA damage response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0031297",
                "name": "replication fork processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "335dffd5c2280cfe75398ccf9497010a985145d3",
        "counters": {
            "domain_architectures": 3432,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3432
        }
    }
}