GET /api/protein/UniProt/A0A8C5YP36/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C5YP36",
        "id": "A0A8C5YP36_MARMA",
        "source_organism": {
            "taxId": "9994",
            "scientificName": "Marmota marmota marmota",
            "fullName": "Marmota marmota marmota (Alpine marmot)"
        },
        "name": "Gamma-interferon-inducible lysosomal thiol reductase",
        "description": [
            "Lysosomal thiol reductase that can reduce protein disulfide bonds. Facilitates the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing",
            "Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds. Also facilitates MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation"
        ],
        "length": 249,
        "sequence": "MPGQLGGNEPETPAQATAVLSGQDTAPGAAPAHTRPVPCSWQVHDLCLREPLKKSSELLVNVSLYYESLCGGCRYFLVRDLFPTWLMVMEILNVTLVPYGNAQERNVSGTWEFTCQHGELECQLNKVEACLLDQLENSAAFLTIVCLEQLDDMEKHLKPCLELYAPEVSPDSIMDCATGARGTQLMHANAQLTDALQPPHQYVPWILVNGKPLKDPSQLLSLVCQLYQGEEKPDVCSSMAITPREVCYK",
        "proteome": "UP000694407",
        "gene": "IFI30",
        "go_terms": [
            {
                "identifier": "GO:0016671",
                "name": "oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "853015c014260417052ba89629369618596d047b",
        "counters": {
            "domain_architectures": 7345,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7345
        }
    }
}