General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C5UR98",
        "id": "A0A8C5UR98_MICMU",
        "source_organism": {
            "taxId": "30608",
            "scientificName": "Microcebus murinus",
            "fullName": "Microcebus murinus (Gray mouse lemur)"
        },
        "name": "Rab GDP dissociation inhibitor",
        "description": [
            "GDP-dissociation inhibitor preventing the GDP to GTP exchange of most Rab proteins. By keeping these small GTPases in their inactive GDP-bound form regulates intracellular membrane trafficking. Negatively regulates protein transport to the cilium and ciliogenesis through the inhibition of RAB8A",
            "Regulates the GDP/GTP exchange reaction of most RAB proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP"
        ],
        "length": 444,
        "sequence": "MPNQEPDFEITSLGECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKLPGTPPASMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDTRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICVLSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPTDLGTESQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED",
        "proteome": "UP000694394",
        "gene": "GDI2",
        "go_terms": [
            {
                "identifier": "GO:0005092",
                "name": "GDP-dissociation inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007264",
                "name": "small GTPase-mediated signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005093",
                "name": "Rab GDP-dissociation inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015031",
                "name": "protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bf4a0619627864712015915d155a6b211ace67a2",
        "counters": {
            "domain_architectures": 9748,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9748
        }
    }
}