GET /api/protein/UniProt/A0A8C5LVW9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C5LVW9",
        "id": "A0A8C5LVW9_9ANUR",
        "source_organism": {
            "taxId": "445787",
            "scientificName": "Leptobrachium leishanense",
            "fullName": "Leptobrachium leishanense (Leishan spiny toad)"
        },
        "name": "Alanine--glyoxylate aminotransferase 2, mitochondrial",
        "description": [
            "Multifunctional aminotransferase with a broad substrate specificity. Catalyzes the conversion of glyoxylate to glycine using alanine as the amino donor. Catalyzes metabolism of not L- but the D-isomer of D-beta-aminoisobutyric acid to generate 2-methyl-3-oxopropanoate and alanine. Catalyzes the transfer of the amino group from beta-alanine to pyruvate to yield L-alanine and 3-oxopropanoate. Can metabolize NG-monomethyl-L-arginine (NMMA), asymmetric NG,NG-dimethyl-L-arginine (ADMA) and symmetric NG,N'G-dimethyl-L-arginine (SDMA). ADMA is a potent inhibitor of nitric-oxide (NO) synthase, and this activity provides mechanism through which the kidney regulates blood pressure"
        ],
        "length": 476,
        "sequence": "MKSTKIMARSLGNHSLIPFIRSQTPRLTGVSYRELSSSSVLPEMPPCDFKPEKYESLPYERIVDIRQHHLSPALKTCYKKPLLLHQGHMQWLYDADGRRYLDLFAGIVTASVGHCHPKVTEAAQKQIGRLGHTTNIYLHSPIHEYAEKLTSLLPGKLKVLYLTNSGSEANDMALYMSRLYTGNFDIVGLRTGYHGASPYALGMTAHTDYKGGVANGFGCHSAMCPDVFGGIWGGSHCRDSPVQTIRKCSCSPGWCEAKDKYIAQFKETLSTCTSKKIAAFIAEPIQGVGGVVQYPKGFLKEAYELIRERGGVCISDEVQTGFGRTGSHYWGFQTHDIMPDIVTMAKGIGNGFPMAAVVTTAEIANVFAQSLHFNTFGGNPVACSVGSAVLDAIEEDGLQKNCEVVGTYMLKKLEKLRDRFEIVGDVRGKGLMVGVEMVKDKVFRIKPPMCITKDDVDFAVEVLQVALTKHVDRTLT",
        "proteome": "UP000694569",
        "gene": "AGXT2",
        "go_terms": [
            {
                "identifier": "GO:0030170",
                "name": "pyridoxal phosphate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "77cca87d6dced57500d02f1f72b680f70c660080",
        "counters": {
            "domain_architectures": 185394,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "cathgene3d": 2,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 185394
        }
    }
}