GET /api/protein/UniProt/A0A8C5KV21/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C5KV21",
        "id": "A0A8C5KV21_JACJA",
        "source_organism": {
            "taxId": "51337",
            "scientificName": "Jaculus jaculus",
            "fullName": "Jaculus jaculus (Lesser Egyptian jerboa)"
        },
        "name": "Transcription factor IIIB 50 kDa subunit",
        "description": [
            "General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. Contributes to the regulation of gene expression; functions as activator in the absence of oxidative stress. Down-regulates expression of target genes in response to oxidative stress. Overexpression protects cells against apoptosis in response to oxidative stress"
        ],
        "length": 396,
        "sequence": "MPGGSYPDCGSSKLVEDSHYSQNQLVCWDCGCVVTEGVLTTTFSEEGNLREVTYSRSTGENEQVSGSQQRVLKLPPTFEDTAIAYYQKAYWLSGIRAVRLQKKEVLVGYCVLITCRQHNWPLTMGAICTLLYADLDVFSGTYMQIVKLLGLDVPSLCLADLVKTYCGSFRLFHASPSVPAKYIEDQEKMLSRTLQLVDLANEAWLVTRRHPLPVVTAATFLAWQSLRPSDRLARFCKLANVDLPYRAVSRLQELLGILLQMAKQLAWLQVLKLDKRSVVKHIGDLLKHHHMLLRMAFRDGTAELETQEKTPEQGQGEEVGLDSFSLPKGKQPASPYLLLPPCMLKSPKQMQPTPPASTVTGDEDISDSEIEQYLRIPQEIRDFEKAQAAISVPSPS",
        "proteome": "UP000694385",
        "gene": "LOC101616908",
        "go_terms": [
            {
                "identifier": "GO:0006352",
                "name": "DNA-templated transcription initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0070897",
                "name": "transcription preinitiation complex assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eae2d53f2dbd08f2761d3a53e2b1114a3b48bb8f",
        "counters": {
            "domain_architectures": 666,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 666
        }
    }
}