HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C5KS82",
"id": "A0A8C5KS82_JACJA",
"source_organism": {
"taxId": "51337",
"scientificName": "Jaculus jaculus",
"fullName": "Jaculus jaculus (Lesser Egyptian jerboa)"
},
"name": "Platelet-derived growth factor subunit A",
"description": [
"Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB"
],
"length": 196,
"sequence": "MRTWACLLLLGCGYLAHALAEEAEIPRELIERLARSQIHSIRDLQRLLEIDSVGADDALETSLRVHGAHATKHAPEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVRCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVKLEEHLECACATSSPSPDHREQETDVR",
"proteome": "UP000694385",
"gene": "Pdgfa",
"go_terms": [
{
"identifier": "GO:0008083",
"name": "growth factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b9876a382d1187221806a8deed9f3f715763252c",
"counters": {
"domain_architectures": 2203,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"smart": 1,
"cdd": 1,
"pfam": 2,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2203
}
}
}