General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C5K5S2",
        "id": "A0A8C5K5S2_JACJA",
        "source_organism": {
            "taxId": "51337",
            "scientificName": "Jaculus jaculus",
            "fullName": "Jaculus jaculus (Lesser Egyptian jerboa)"
        },
        "name": "Glycogenin-1",
        "description": [
            "Glycogenin participates in the glycogen biosynthetic process along with glycogen synthase and glycogen branching enzyme. It catalyzes the formation of a short alpha (1,4)-glucosyl chain covalently attached via a glucose 1-O-tyrosyl linkage to internal tyrosine residues and these chains act as primers for the elongation reaction catalyzed by glycogen synthase"
        ],
        "length": 343,
        "sequence": "TLTTNDAYAKGALVLGSSLKQHRTTGKLVVLTTPQVSDSMRKVLETVFDEVLTVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLALTNIDDLFEREELSAAPDPGWPDCFNSGVFVFQPSMETYSQLLQLASEQGSFDGGDQGLLNTYFSNWATTDIRKHLPFIYNLSSISIYSYLPAFQVFGANAKVVHFLGQIKPWNYTYDPHTKSVKSESHDPSMMHPEFLNLWWDTFSTQILPLFQHHGLVKDTHSYINVLSDLVYTLAFSCGFCRKEQVSGAMSHLLLGEVPAPPQPSVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ",
        "proteome": "UP000694385",
        "gene": "Gyg1",
        "go_terms": [
            {
                "identifier": "GO:0016757",
                "name": "glycosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c94647be06e40a638688f530ad619dabee70dfec",
        "counters": {
            "domain_architectures": 38856,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 38856
        }
    }
}