GET /api/protein/UniProt/A0A8C5K1T6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C5K1T6",
        "id": "A0A8C5K1T6_JACJA",
        "source_organism": {
            "taxId": "51337",
            "scientificName": "Jaculus jaculus",
            "fullName": "Jaculus jaculus (Lesser Egyptian jerboa)"
        },
        "name": "Succinate dehydrogenase assembly factor 3",
        "description": [
            "Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1"
        ],
        "length": 125,
        "sequence": "MPGLHTSRVRALYRRILQLHRVLPPDLKALGDQYVKDEFRRHKTVGSDEAQRFLQEWEAYAAVLWQQAKDNRQNSTEKTCFGISLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSIIESTKPKL",
        "proteome": "UP000694385",
        "gene": "Sdhaf3",
        "go_terms": [
            {
                "identifier": "GO:0034553",
                "name": "mitochondrial respiratory chain complex II assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005739",
                "name": "mitochondrion",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "279d9d6b53624452bcf3c13efe7dd7f45beefd56",
        "counters": {
            "domain_architectures": 7403,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7403
        }
    }
}