General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C5IBU6",
        "id": "A0A8C5IBU6_JUNHY",
        "source_organism": {
            "taxId": "40217",
            "scientificName": "Junco hyemalis",
            "fullName": "Junco hyemalis (Dark-eyed junco)"
        },
        "name": "Calretinin",
        "description": [
            "Calcium-binding protein involved in calcium homeostasis and signal transduction. It plays a critical role in buffering intracellular calcium levels and modulating calcium-dependent signaling pathways. Predominantly expressed in specific neuronal populations, influences synaptic plasticity and neuronal excitability, contributing to learning and memory. During embryonic development, it facilitates neuronal differentiation and maturation"
        ],
        "length": 270,
        "sequence": "MAGPQQAPHLHLAELTASQFLDIWRHFDADGNGYIEGKELENFFQELESARKGAGVDSKKDNLGDKMKEFMHKYDKNADGKIEMAELAQILPTEENFLLCFRQHVGSSSEFMEAWRRYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDMNGDGKLGLSEMSRLLPVQENFLLKFQGMKLSSDEFNAIFAFYDKDGNGFIDENELDALLKDLYEKNKKEMNIQQLTNYRKSIMNLSDGGKLYRKELEMVLCNEPPM",
        "proteome": "UP000694408",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "21b235b3331b4ebbf814479125f29d8b919c5089",
        "counters": {
            "domain_architectures": 737,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 737
        }
    }
}