HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C5DWT8",
"id": "A0A8C5DWT8_GOUWI",
"source_organism": {
"taxId": "441366",
"scientificName": "Gouania willdenowi",
"fullName": "Gouania willdenowi (Blunt-snouted clingfish)"
},
"name": "Ras-related protein Rab-3",
"description": [
"The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion"
],
"length": 225,
"sequence": "MDLYGKMAATQDVRGKAEGGDQNFDYMFKLLIIGNSSVGKTSFLFRYADDAFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFGAVQDWSTQIKTYSWDNAQVVLAGNKCDMEEERVVSVDSGRLLAEQLGFEFFETSAKDNINVKQTFERLVDLICDKMSDSMDGDPAATTGAPTAKLTDSAPPLQQPSCNC",
"proteome": "UP000694680",
"gene": "rab3c",
"go_terms": [
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "31aa1b32c82271990f81b4779ae58d1cb9b14b00",
"counters": {
"domain_architectures": 273930,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 3,
"ssf": 1,
"ncbifam": 1,
"cdd": 1,
"smart": 4,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 273930
}
}
}