GET /api/protein/UniProt/A0A8C5DWT8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C5DWT8",
        "id": "A0A8C5DWT8_GOUWI",
        "source_organism": {
            "taxId": "441366",
            "scientificName": "Gouania willdenowi",
            "fullName": "Gouania willdenowi (Blunt-snouted clingfish)"
        },
        "name": "Ras-related protein Rab-3",
        "description": [
            "The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion"
        ],
        "length": 225,
        "sequence": "MDLYGKMAATQDVRGKAEGGDQNFDYMFKLLIIGNSSVGKTSFLFRYADDAFTSAFVSTVGIDFKVKTVYKNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFGAVQDWSTQIKTYSWDNAQVVLAGNKCDMEEERVVSVDSGRLLAEQLGFEFFETSAKDNINVKQTFERLVDLICDKMSDSMDGDPAATTGAPTAKLTDSAPPLQQPSCNC",
        "proteome": "UP000694680",
        "gene": "rab3c",
        "go_terms": [
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "31aa1b32c82271990f81b4779ae58d1cb9b14b00",
        "counters": {
            "domain_architectures": 273930,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 3,
                "ssf": 1,
                "ncbifam": 1,
                "cdd": 1,
                "smart": 4,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 273930
        }
    }
}