HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C4X8E0",
"id": "A0A8C4X8E0_ERPCA",
"source_organism": {
"taxId": "27687",
"scientificName": "Erpetoichthys calabaricus",
"fullName": "Erpetoichthys calabaricus (Rope fish)"
},
"name": "Non-selective voltage-gated ion channel VDAC1",
"description": [
"Catalyzes the scrambling of phospholipids across the outer mitochondrial membrane; the mechanism is unrelated to channel activity and is capable of translocating both anionic and zwitterionic phospholipids"
],
"length": 283,
"sequence": "MEVPPAYVDLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANIETSKVTGSLETKYKWVEHGLTFTEKWNTDNTLGTEITIEDQLAKGLKLTFDSSFSPNTGKKSGKIKTGYKREHINMGCDVDFDIAGPSVRGAVVFGYEGWLAGYQMTFEAGKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNEKLETAVNLAWTAGNSNTRFGIAAKYQIDTDASFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFEA",
"proteome": "UP000694620",
"gene": "VDAC1",
"go_terms": [
{
"identifier": "GO:0008308",
"name": "voltage-gated monoatomic anion channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0098656",
"name": "monoatomic anion transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005741",
"name": "mitochondrial outer membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b61af2137f24347970cf1481b12e2dc4b115f98c",
"counters": {
"domain_architectures": 17869,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17869
}
}
}