GET /api/protein/UniProt/A0A8C4S839/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C4S839",
"id": "A0A8C4S839_ERPCA",
"source_organism": {
"taxId": "27687",
"scientificName": "Erpetoichthys calabaricus",
"fullName": "Erpetoichthys calabaricus (Rope fish)"
},
"name": "Calcium uniporter protein",
"description": [
"Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria. Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways"
],
"length": 368,
"sequence": "MAAAASRSYVFVAPCSRVLTPGLSSLGIARHRHHSHHRPDSSADAFVHHSVRRLHSRSTLISRSASQFQVWQNGPIFQSQRRLCSSEVTPSSDVNVAYHNGLPVISVNLPSRRERCQFTLKPISDSVGVFLEQLKAEDRGIDRVAIYSTDGTRVASSTGIDILLLDEFNLIINDTTYLVRPPKRDLLSSEDTETMNDVKRLVQQLYTTLHIEEHQLQKERELIGRLENLNSQLLPLEKVKEELSRKAAKRTTWVLWGGMAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVLTRQEYIYPDARDRQFLHFFHKGVKKNRFDVDKYNQLKDAIAQAELDLKRLRDPLQLHLPIQQIKD",
"proteome": "UP000694620",
"gene": "MCU",
"go_terms": [
{
"identifier": "GO:0051560",
"name": "mitochondrial calcium ion homeostasis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "88bf831b8e53a13f29479c42b5a7c84388b9ea01",
"counters": {
"domain_architectures": 7126,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7126
}
}
}