General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C4NNR7",
        "id": "A0A8C4NNR7_DICLA",
        "source_organism": {
            "taxId": "13489",
            "scientificName": "Dicentrarchus labrax",
            "fullName": "Dicentrarchus labrax (European seabass)"
        },
        "name": "tRNA N(3)-cytidine methyltransferase METTL6",
        "description": [
            "S-adenosyl-L-methionine-dependent methyltransferase that mediates N(3)-methylcytidine modification of residue 32 of the tRNA anticodon loop of tRNA(Ser), including tRNA(Ser)(UGA) and tRNA(Ser)(GCU). Interaction with SARS1/SerRS is required for N(3)-methylcytidine methylation"
        ],
        "length": 310,
        "sequence": "MARSEETRFPGDVKMTATEEDVGSKDEGSKDVVSPCVPAQTKTSAARGLTAEGPQRVGGERALVSDFKHMKLEKEAQKNWDLFYKRNATHFFKDRHWTTREFEELQACREFESQRLVLLEAGCGVGNCIFPLLEDDLNIFVYACDFSPRAVEFVKQNPLYCPERCCAFQCDLTNDDLRDNVPEGSVDVITLIFVLSAIHPDKMKLALQNISRVLKPGGIVLFRDYGLHDHAMLRFKAGSKLGENFYVRQDGTRSYFFSKEFLAELFEDTGLQSVSNDYVLRETVNKKEGLCVPRVFLQSKFTKPGRPQSS",
        "proteome": "UP000694389",
        "gene": "mettl6",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c043aa35505ceaded7954fe53dbc11785f5f9abb",
        "counters": {
            "domain_architectures": 25086,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25086
        }
    }
}