HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C4N2C3",
"id": "A0A8C4N2C3_EQUAS",
"source_organism": {
"taxId": "83772",
"scientificName": "Equus asinus asinus",
"fullName": "Equus asinus asinus"
},
"name": "Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial",
"description": [
"Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro)"
],
"length": 425,
"sequence": "MNYSRFLTAQSAARKPSAIRLLTELLGKIPKSTISLAPGAPNPNVFPFKTVAVTLEDGKTIEFHEEMMKKALQYSPSSGIPELLSWLKQLQIRLHNPPTIHYPSSQGQMEICVTSGSQDGLCKAFEMIINPGDNILISEPVYPGTLQALQPLGCNIINVSSDEYGIIPDSLREILSKWKPEDSKDPKKNTPKFLYIIPNGSNPTGDSLTANRKKEIYELARKYDFLIIEDDPYYFLQFNKPWVPSFLSMDVDGRVIRADSFSKVLSSGLRIGFITGPKRLIERIVLHTQVSSLHPNTFAQSLLVSALNKLNTSFSLFSSSRVAQFYRNQKDALLAAADKWLSGLAEWHVPTGGIFLWIKIKGINDVTHLIEEKALKNEVLVTPGNVFFIDSSAPCPYFRVSYSLASPEEMDVALQRLAQVIRESL",
"proteome": null,
"gene": "AADAT",
"go_terms": [
{
"identifier": "GO:0030170",
"name": "pyridoxal phosphate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008483",
"name": "transaminase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "220d43766bfe69807874ea078bc783ea7854e968",
"counters": {
"domain_architectures": 344728,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"cdd": 1,
"pfam": 1,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 344728
}
}
}