GET /api/protein/UniProt/A0A8C4N2C3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C4N2C3",
        "id": "A0A8C4N2C3_EQUAS",
        "source_organism": {
            "taxId": "83772",
            "scientificName": "Equus asinus asinus",
            "fullName": "Equus asinus asinus"
        },
        "name": "Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial",
        "description": [
            "Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro)"
        ],
        "length": 425,
        "sequence": "MNYSRFLTAQSAARKPSAIRLLTELLGKIPKSTISLAPGAPNPNVFPFKTVAVTLEDGKTIEFHEEMMKKALQYSPSSGIPELLSWLKQLQIRLHNPPTIHYPSSQGQMEICVTSGSQDGLCKAFEMIINPGDNILISEPVYPGTLQALQPLGCNIINVSSDEYGIIPDSLREILSKWKPEDSKDPKKNTPKFLYIIPNGSNPTGDSLTANRKKEIYELARKYDFLIIEDDPYYFLQFNKPWVPSFLSMDVDGRVIRADSFSKVLSSGLRIGFITGPKRLIERIVLHTQVSSLHPNTFAQSLLVSALNKLNTSFSLFSSSRVAQFYRNQKDALLAAADKWLSGLAEWHVPTGGIFLWIKIKGINDVTHLIEEKALKNEVLVTPGNVFFIDSSAPCPYFRVSYSLASPEEMDVALQRLAQVIRESL",
        "proteome": null,
        "gene": "AADAT",
        "go_terms": [
            {
                "identifier": "GO:0030170",
                "name": "pyridoxal phosphate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008483",
                "name": "transaminase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "220d43766bfe69807874ea078bc783ea7854e968",
        "counters": {
            "domain_architectures": 344728,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 344728
        }
    }
}