GET /api/protein/UniProt/A0A8C4MQS6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C4MQS6",
"id": "A0A8C4MQS6_EQUAS",
"source_organism": {
"taxId": "9793",
"scientificName": "Equus asinus",
"fullName": "Equus asinus (Donkey)"
},
"name": "DPY30 domain-containing protein 1",
"description": [
"Functions as part of axonemal radial spoke complexes that play an important part in the motility of sperm and cilia. Plays a crucial role during acrosome biogenesis"
],
"length": 177,
"sequence": "MESMYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQQEMADLARERQHALMEQEMMERLRAEELLFQQQQLAFQLELEMQEKERQRTEELQRAQEQLEKEARLDMDSMAKSEDTSHSEDAAADSGKTLAEISDRYGAPNLSRVEELDEPMLSDVALNIDQDL",
"proteome": "UP000694387",
"gene": "DYDC1",
"go_terms": [
{
"identifier": "GO:0048188",
"name": "Set1C/COMPASS complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bbd05bc874aca9367a2c09893abc2ee1fa9ab8f5",
"counters": {
"domain_architectures": 6282,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cdd": 1,
"cathgene3d": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6282
}
}
}