GET /api/protein/UniProt/A0A8C4MQS6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C4MQS6",
        "id": "A0A8C4MQS6_EQUAS",
        "source_organism": {
            "taxId": "9793",
            "scientificName": "Equus asinus",
            "fullName": "Equus asinus (Donkey)"
        },
        "name": "DPY30 domain-containing protein 1",
        "description": [
            "Functions as part of axonemal radial spoke complexes that play an important part in the motility of sperm and cilia. Plays a crucial role during acrosome biogenesis"
        ],
        "length": 177,
        "sequence": "MESMYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQQEMADLARERQHALMEQEMMERLRAEELLFQQQQLAFQLELEMQEKERQRTEELQRAQEQLEKEARLDMDSMAKSEDTSHSEDAAADSGKTLAEISDRYGAPNLSRVEELDEPMLSDVALNIDQDL",
        "proteome": "UP000694387",
        "gene": "DYDC1",
        "go_terms": [
            {
                "identifier": "GO:0048188",
                "name": "Set1C/COMPASS complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bbd05bc874aca9367a2c09893abc2ee1fa9ab8f5",
        "counters": {
            "domain_architectures": 6282,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6282
        }
    }
}