GET /api/protein/UniProt/A0A8C4LRB8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C4LRB8",
"id": "A0A8C4LRB8_EQUAS",
"source_organism": {
"taxId": "9793",
"scientificName": "Equus asinus",
"fullName": "Equus asinus (Donkey)"
},
"name": "Type 2 lactosamine alpha-2,3-sialyltransferase",
"description": [
"Transfers the sialyl residue from CMP-N-acetyl-beta-neuraminate to the terminal galactose residue on sugar chains of glycoproteins and glycolipids. It's alpha-2,3-sialyltransferase activity is specific toward type II glycan chains (Galbeta1-4GlcNAc) on glycoproteins and glycolipids such as neolactosides nLc4Cer and nLc6Cer, whose sialyl-products serve as precursors for the Lewis X antigen. Critically involved in the synthesis of functional selectin ligands needed for neutrophil recruitment during inflammation and lymphocyte homing to the lymph nodes"
],
"length": 314,
"sequence": "MCFREQRSKLNCATAMRGYLVAIFLSAIFLYYVLHCISWGTSVYWAHPVEMQQRKRGQPCREKPAFASLLRFHEFHPFLCASDFKKIASLYGGDKFSLPYGIKASEEPFRLALSALQSCDLFDEFDTMNNGPVLGHEEDVGRRTTFRLFYPESVFTDSNHRDPNTTAILTAFKPLDLKWLYDLLMGSKIDTKGFWQKPALDLIYKPYQIRILDPFITRTAAYELLHFPKVFPKNQKRKHPTTGIIAITLAFHICHEVHLAGFKYNFSDLKSPLHYYGNSTMSLMNASSYHNLTAEQLFLKDIIEKNFVINLTQD",
"proteome": "UP000694387",
"gene": "ST3GAL6",
"go_terms": [
{
"identifier": "GO:0008373",
"name": "sialyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009101",
"name": "glycoprotein biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "539ba3211ecb1f85127c965aa98c3308f6899026",
"counters": {
"domain_architectures": 29312,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pirsf": 1,
"pfam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 29312
}
}
}