GET /api/protein/UniProt/A0A8C4LRB8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C4LRB8",
        "id": "A0A8C4LRB8_EQUAS",
        "source_organism": {
            "taxId": "9793",
            "scientificName": "Equus asinus",
            "fullName": "Equus asinus (Donkey)"
        },
        "name": "Type 2 lactosamine alpha-2,3-sialyltransferase",
        "description": [
            "Transfers the sialyl residue from CMP-N-acetyl-beta-neuraminate to the terminal galactose residue on sugar chains of glycoproteins and glycolipids. It's alpha-2,3-sialyltransferase activity is specific toward type II glycan chains (Galbeta1-4GlcNAc) on glycoproteins and glycolipids such as neolactosides nLc4Cer and nLc6Cer, whose sialyl-products serve as precursors for the Lewis X antigen. Critically involved in the synthesis of functional selectin ligands needed for neutrophil recruitment during inflammation and lymphocyte homing to the lymph nodes"
        ],
        "length": 314,
        "sequence": "MCFREQRSKLNCATAMRGYLVAIFLSAIFLYYVLHCISWGTSVYWAHPVEMQQRKRGQPCREKPAFASLLRFHEFHPFLCASDFKKIASLYGGDKFSLPYGIKASEEPFRLALSALQSCDLFDEFDTMNNGPVLGHEEDVGRRTTFRLFYPESVFTDSNHRDPNTTAILTAFKPLDLKWLYDLLMGSKIDTKGFWQKPALDLIYKPYQIRILDPFITRTAAYELLHFPKVFPKNQKRKHPTTGIIAITLAFHICHEVHLAGFKYNFSDLKSPLHYYGNSTMSLMNASSYHNLTAEQLFLKDIIEKNFVINLTQD",
        "proteome": "UP000694387",
        "gene": "ST3GAL6",
        "go_terms": [
            {
                "identifier": "GO:0008373",
                "name": "sialyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009101",
                "name": "glycoprotein biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "539ba3211ecb1f85127c965aa98c3308f6899026",
        "counters": {
            "domain_architectures": 29312,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pirsf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29312
        }
    }
}