General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C4ERI6",
        "id": "A0A8C4ERI6_DICLA",
        "source_organism": {
            "taxId": "13489",
            "scientificName": "Dicentrarchus labrax",
            "fullName": "Dicentrarchus labrax (European seabass)"
        },
        "name": "AP-1 complex subunit mu-1",
        "description": [
            "Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules"
        ],
        "length": 431,
        "sequence": "HLAVQQLLLSFDIAKCTNTICSFQVLVCRNYRGDVDMSEIEHFMTLLMDKEEEGTLSPILAHGGVRFMWIKHNNLYLVATSKKNASVSLVFSFLYKIVFSEYFKELEEESIRDNFVIIYELMDELMDFGYPQTTDSKILQEYITQEGHKLDTGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFENTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPTDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ",
        "proteome": "UP000694389",
        "gene": "ap1m1",
        "go_terms": [
            {
                "identifier": "GO:0006886",
                "name": "intracellular protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016192",
                "name": "vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030131",
                "name": "clathrin adaptor complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "69beb5a3dc5f8581f8310e6698a66f3e65ea6ecf",
        "counters": {
            "domain_architectures": 14422,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 2,
                "profile": 1,
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14422
        }
    }
}