General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C3V8K8",
        "id": "A0A8C3V8K8_CATUS",
        "source_organism": {
            "taxId": "91951",
            "scientificName": "Catharus ustulatus",
            "fullName": "Catharus ustulatus (Russet-backed thrush)"
        },
        "name": "Protein Mdm4",
        "description": [
            "Inhibits p53- and p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain"
        ],
        "length": 451,
        "sequence": "RMSFPNSSQHPGAGNSCRISLGQGNQVIPKVPLLRILQAAGAQGETFTLKEVMHFLGQYIMGRQLYDKRQQHLVHCGGDPLGELLGLQSFSVKDPSPVYEMLKRNLSPAALPGRSFLSMNVLCLVSTVRNNTKYRNSPNGTVPKYRNNKDLTENLSKNKKPKLDLVFEEWDVAGLPWWFLGNLRSNYKSRSNGSTDIQTNQDIDTAIVSDTTDDLWFLNEAPLEQSSAALKVLDSEEVTEGDTKVPEDECLEELEDSQCLSDDTDTEAASEDCWQCSKCKKFNSPGKRYCYRCWALRKDWYRDCPKLPHSLSLSNINSMEKQEQDDGMDVPDCRRTISAPAGQAKHLFLAESKPHMDPGDSIDSLDLARDGKSRDFAKLKKEEEMESLESIKTLLNPCFLCQHRPRDGNIVHGRTAHLVACFRCARMLKKKKSPCPVCRKEIKMVIRIFMG",
        "proteome": "UP000694563",
        "gene": "MDM4",
        "go_terms": [
            {
                "identifier": "GO:0043066",
                "name": "negative regulation of apoptotic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0051726",
                "name": "regulation of cell cycle",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "13a552fd6cd76eed10d620264b6a007941ee2a48",
        "counters": {
            "domain_architectures": 32271,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 2,
                "profile": 2,
                "cdd": 2,
                "pfam": 1,
                "pirsf": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32271
        }
    }
}