GET /api/protein/UniProt/A0A8C3NQE0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C3NQE0",
        "id": "A0A8C3NQE0_GEOPR",
        "source_organism": {
            "taxId": "87175",
            "scientificName": "Geospiza parvula",
            "fullName": "Geospiza parvula (Small tree-finch)"
        },
        "name": "Acid-sensing ion channel 1",
        "description": [
            "Forms voltage-independent, pH-gated trimeric sodium channels that act as postsynaptic excitatory receptors in the nervous system, playing a crucial role in regulating synaptic plasticity, learning, and memory. Upon extracellular pH drop this channel elicits transient, fast activating, and completely desensitizing inward currents. Displays high selectivity for sodium ions but can also permit the permeation of other cations. Regulates more or less directly intracellular calcium concentration and CaMKII phosphorylation, and thereby the density of dendritic spines. Modulates neuronal activity in the circuits underlying innate fear"
        ],
        "length": 527,
        "sequence": "MMDLKVDEEEVDSGQPVSIQAFASSSTLHGLSHIFSYERLSLKRVVWALCFLGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDIQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCTPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKAVAGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCICEMPCNMTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCRKNHKRNNTDKGVALSMDDVKRHNPCESIRGHPAGMTYAANILPHHPARGTFEDFTC",
        "proteome": "UP000694382",
        "gene": "ASIC1",
        "go_terms": [
            {
                "identifier": "GO:0005272",
                "name": "sodium channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006814",
                "name": "sodium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015280",
                "name": "ligand-gated sodium channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "35aa8b3fca15bf8fdbd42d12380031325608b3e4",
        "counters": {
            "domain_architectures": 25165,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25165
        }
    }
}