General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C3NKI5",
        "id": "A0A8C3NKI5_GEOPR",
        "source_organism": {
            "taxId": "87175",
            "scientificName": "Geospiza parvula",
            "fullName": "Geospiza parvula (Small tree-finch)"
        },
        "name": "Probetacellulin",
        "description": [
            "Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells"
        ],
        "length": 186,
        "sequence": "MPPAQGGRGPSCRARCQRPRCGSGAAGGPPLSCLRCLPGLALFSCVGADTNVTAGHGTEGLSCGNGTQPRRQGHFSRCPEEYQHYCVKGRCRFLVAEQAPACVCERGYTGARCERVDLFYLRGDQGQIVIISLIVAIAALIILVVGICLCSHHCRRQRRKRKAEEMETLNKDGPSRSEDVRETGIA",
        "proteome": "UP000694382",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}