GET /api/protein/UniProt/A0A8C3FL81/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C3FL81",
        "id": "A0A8C3FL81_CHRPI",
        "source_organism": {
            "taxId": "8478",
            "scientificName": "Chrysemys picta bellii",
            "fullName": "Chrysemys picta bellii (Western painted turtle)"
        },
        "name": "Dihydropyrimidinase-related protein 1",
        "description": [
            "Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance. During the axon guidance process, acts downstream of SEMA3A to promote FLNA dissociation from F-actin which results in the rearrangement of the actin cytoskeleton and the collapse of the growth cone. Involved in invasive growth and cell migration. May participate in cytokinesis"
        ],
        "length": 684,
        "sequence": "MAERKRTWNKEDDLPVYLARPGTTAQTPRQKYGGMFASVEGAYENKTIDFDAYSVGKKGSRTPRSGSRHDMMLDGGDNYSETASDVSEVSGSVISSPGDRDDKTPGIEIKYPTGKELLQGQDNGKSDRLLIKGGRIINDDYSFYADIYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPYQGMTAVDDFYQGTKAALAGGTTMIIDHVVPEAGVSLLTSFEKWHEAADTKSCCDYSLHVDITNWYDGIREELDILVQDKGVNSFQVYMAYKDLYQMSDSQLYEAFTFLKGLGAVIMVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIASRINCPVYITKVMSKSAADIIALARKKGPLVFGEPITASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTADHLNSLLACGDLQVTGSGHCPYSTAQRAIGKDNFTLIPEGVNGIEERMTVVWDKAVAIGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKVKIITAKSHKSAVEYNIFEGMECHGAPLVVISQGKIVFEDGNLHVNKGMGRFIPRKPFPEYLYQRIKIRNKVTGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPAKNQPPPIRNLHQSNFSLSGAQADDNNPRRTGHRIVAPPGGRSNITSLG",
        "proteome": "UP000694380",
        "gene": "CRMP1",
        "go_terms": [
            {
                "identifier": "GO:0016810",
                "name": "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "51d6f0d2568382f7084989f0f7cdc72064d17026",
        "counters": {
            "domain_architectures": 188509,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 188509
        }
    }
}