General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C3FKS1",
        "id": "A0A8C3FKS1_CHRPI",
        "source_organism": {
            "taxId": "8478",
            "scientificName": "Chrysemys picta bellii",
            "fullName": "Chrysemys picta bellii (Western painted turtle)"
        },
        "name": "Leukemia inhibitory factor",
        "description": [
            "LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes"
        ],
        "length": 198,
        "sequence": "MIHCRLVVGKALPVNTPSPMCENTHVCKPNVAEQTRKLVVLLNATAQDLFSIYLDCQGDPFSSHLDELCNANGTNFPDFDVNRTSHKKEIMVALYKVFAFLNASLGNITRDQEELNPTAKELRERLQNTTKTTRGLISNLTCLLCTNYKVSQVDVTYGKSSKGMTVFKKKQQGCQVLRRYVQVVSQAAQVLLPHLSQA",
        "proteome": "UP000694380",
        "gene": "LIF",
        "go_terms": [
            {
                "identifier": "GO:0005125",
                "name": "cytokine activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006955",
                "name": "immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005146",
                "name": "leukemia inhibitory factor receptor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3c015d0ef00e794ed85a4af2ff881a3ea205ac18",
        "counters": {
            "domain_architectures": 981,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 981
        }
    }
}