GET /api/protein/UniProt/A0A8C3F3N1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C3F3N1",
"id": "A0A8C3F3N1_CHRPI",
"source_organism": {
"taxId": "8478",
"scientificName": "Chrysemys picta bellii",
"fullName": "Chrysemys picta bellii (Western painted turtle)"
},
"name": "Leucine carboxyl methyltransferase 1",
"description": [
"Methylates the carboxyl group of the C-terminal leucine residue of protein phosphatase 2A catalytic subunits to form alpha-leucine ester residues"
],
"length": 329,
"sequence": "MATAVRDTLCFAGSEEADEAVRGTCEDASICKRFAVSIGYWKDPYIQYFVRQAKERKAPEINRGYYARVHGVSQLLKAFLKETECNCQIINLGAGLDTMFWRLKDENLLPKKYFEVDFPMIVARKIYNIKSKPPLSKPIMESHSGESFLIDAHSLDSSRYAILAADLREAAELEEKLKKFNMDTQLPTLLIAECVLVYMTPEQSASLLKWAANTFQTAMVINYEQVNMADRFGQIMIENLQRRQCSLAGVEACKSLDSQRERLLLNGWETANAIDMMKVYSYLPQADVKRIEGLEFLDEKELLEQLMQHYCICWATKDSCNLGLSNITF",
"proteome": "UP000694380",
"gene": "LCMT1",
"go_terms": [
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0032259",
"name": "methylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c39ca5322b0803395216e541e0951748cfe0f4b5",
"counters": {
"domain_architectures": 22760,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pirsf": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 22760
}
}
}