General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C3EBK2",
        "id": "A0A8C3EBK2_CORMO",
        "source_organism": {
            "taxId": "1196302",
            "scientificName": "Corvus moneduloides",
            "fullName": "Corvus moneduloides (New Caledonian crow)"
        },
        "name": "V-set domain containing T cell activation inhibitor 1",
        "description": [
            "Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation"
        ],
        "length": 290,
        "sequence": "MACEAGGLRGNVVLPFFPNSMTTVIIILAAVIALIIGFGVSGKHSISVTALTSAGNIGQRSILGCTFEPDIRMDSIAIQWAKEGVAGLVHEFKGGKDHLQEQDPSFQGRTAMFADQVIGGNASLELRDVQLSDAGTYRCSVITARGSGAAVLRYRTGAFSIPMVQVESSGRGDTLQCTAPRWFPRPAVCWTAYGDTGEHLPHAANTSYELNPENITVRVVSLLHNVTANATYTCMIENSIAKAMGNIRVTDFSITKVTNLQLVNLNAESVSSSFPACHWMLLLSLYLLSI",
        "proteome": "UP000694553",
        "gene": "VTCN1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1f4b91bbf1300013183d4174ce2eb131097865f5",
        "counters": {
            "domain_architectures": 7439,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 2,
                "ssf": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7439
        }
    }
}