GET /api/protein/UniProt/A0A8C2Z755/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C2Z755",
        "id": "A0A8C2Z755_CYCLU",
        "source_organism": {
            "taxId": "8103",
            "scientificName": "Cyclopterus lumpus",
            "fullName": "Cyclopterus lumpus (Lumpsucker)"
        },
        "name": "pepsin A",
        "description": [
            "Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent"
        ],
        "length": 374,
        "sequence": "MKLLVVLSALLAFSECFHKISLIKGKTARQDLQEKGLWEEYRKQYPYNPAAKFYQTGSEAMTNDADLSYYGVISIGTPPQSFSVVFDTGSSNLWVPSIYCSSPACNNHRKFNPSQSSTFKWGSETLSIQYGTGSMTGRLAIDNVEVGGITVSNQVFGISRTEAPFMTHMISDGILGLAFQSIASDQVVPVFDNMVKDGLVSQSVFSVYLSRNSEQGSEVVFGGVDSSHYTGQIRWIPLTSATYWQIKMDSVMINGQTVACAGGCQAIIDTGTSMIVGPTSDIQNINSWIGASTNQYGEAEVNCQNIQHMPEITFTLNGQAFSVPASAYVSNSYNSCHSGFSGDSNLWILGDVFIREFYVIFNSETKTVGLAQSV",
        "proteome": "UP000694565",
        "gene": "LOC117733387",
        "go_terms": [
            {
                "identifier": "GO:0004190",
                "name": "aspartic-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "de427c414184838633fa02c83d7309f50dc3e62c",
        "counters": {
            "domain_architectures": 5938,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 3,
                "pfam": 2,
                "profile": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5938
        }
    }
}