GET /api/protein/UniProt/A0A8C2Z755/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C2Z755",
"id": "A0A8C2Z755_CYCLU",
"source_organism": {
"taxId": "8103",
"scientificName": "Cyclopterus lumpus",
"fullName": "Cyclopterus lumpus (Lumpsucker)"
},
"name": "pepsin A",
"description": [
"Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent"
],
"length": 374,
"sequence": "MKLLVVLSALLAFSECFHKISLIKGKTARQDLQEKGLWEEYRKQYPYNPAAKFYQTGSEAMTNDADLSYYGVISIGTPPQSFSVVFDTGSSNLWVPSIYCSSPACNNHRKFNPSQSSTFKWGSETLSIQYGTGSMTGRLAIDNVEVGGITVSNQVFGISRTEAPFMTHMISDGILGLAFQSIASDQVVPVFDNMVKDGLVSQSVFSVYLSRNSEQGSEVVFGGVDSSHYTGQIRWIPLTSATYWQIKMDSVMINGQTVACAGGCQAIIDTGTSMIVGPTSDIQNINSWIGASTNQYGEAEVNCQNIQHMPEITFTLNGQAFSVPASAYVSNSYNSCHSGFSGDSNLWILGDVFIREFYVIFNSETKTVGLAQSV",
"proteome": "UP000694565",
"gene": "LOC117733387",
"go_terms": [
{
"identifier": "GO:0004190",
"name": "aspartic-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "de427c414184838633fa02c83d7309f50dc3e62c",
"counters": {
"domain_architectures": 5938,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 3,
"pfam": 2,
"profile": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5938
}
}
}