GET /api/protein/UniProt/A0A8C2WTC5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C2WTC5",
        "id": "A0A8C2WTC5_CYCLU",
        "source_organism": {
            "taxId": "8103",
            "scientificName": "Cyclopterus lumpus",
            "fullName": "Cyclopterus lumpus (Lumpsucker)"
        },
        "name": "Arp2/3 complex 34 kDa subunit",
        "description": [
            "Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks"
        ],
        "length": 313,
        "sequence": "MILLEINNRIIEETLSLKFDGAANGTKPEAVDVTFADFDGVLYHISNPNGEKTKVMVSISLKFYKELQEHGADELLKRVYGNFLVSEEDGYNVSLLYDLDALPANKDDVVHQAGMLKRNCFASVFEKYFKFQEEGKEGEKRAVVHYRDDESMYLEAKKDRVTVVFSTVFKDDDDVIIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNINARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTISYFREGGKTFRTNSVFEDKNR",
        "proteome": "UP000694565",
        "gene": "arpc2",
        "go_terms": [
            {
                "identifier": "GO:0030041",
                "name": "actin filament polymerization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0034314",
                "name": "Arp2/3 complex-mediated actin nucleation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005885",
                "name": "Arp2/3 protein complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015629",
                "name": "actin cytoskeleton",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3c0a01558734d1c30b00ab465be0e4c1c675f7bf",
        "counters": {
            "domain_architectures": 5195,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5195
        }
    }
}