HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C2W6F6",
"id": "A0A8C2W6F6_CHILA",
"source_organism": {
"taxId": "34839",
"scientificName": "Chinchilla lanigera",
"fullName": "Chinchilla lanigera (Long-tailed chinchilla)"
},
"name": "Mitogen-activated protein kinase",
"description": [
"Acts as a transcriptional repressor. Binds to a [GC]AAA[GC] consensus sequence. Repress the expression of interferon gamma-induced genes. Seems to bind to the promoter of CCL5, DMP1, IFIH1, IFITM1, IRF7, IRF9, LAMP3, OAS1, OAS2, OAS3 and STAT1. Transcriptional activity is independent of kinase activity"
],
"length": 360,
"sequence": "MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNINKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS",
"proteome": "UP000694398",
"gene": "MAPK1",
"go_terms": [
{
"identifier": "GO:0004672",
"name": "protein kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006468",
"name": "protein phosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004707",
"name": "MAP kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "726173b0dde7bbc50c5d845a39c992d18faf18f3",
"counters": {
"domain_architectures": 887312,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 2,
"pfam": 1,
"smart": 1,
"profile": 1,
"panther": 1,
"prints": 1,
"prosite": 3,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 887312
}
}
}