GET /api/protein/UniProt/A0A8C2VKA0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C2VKA0",
        "id": "A0A8C2VKA0_CHILA",
        "source_organism": {
            "taxId": "34839",
            "scientificName": "Chinchilla lanigera",
            "fullName": "Chinchilla lanigera (Long-tailed chinchilla)"
        },
        "name": "Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial",
        "description": [
            "GTP-specific succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The beta subunit provides nucleotide specificity of the enzyme and binds the substrate succinate, while the binding sites for coenzyme A and phosphate are found in the alpha subunit"
        ],
        "length": 433,
        "sequence": "MMASPAAALAGRLLRDLALRPRFLAPGSQAVQCTSRRWLNLQEYQSKKLMSDNGVRVQRFFVASTANEALEAAKRLNAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPKVVGQLAKQMIGYNLATKQTPKEGVKVNKVMIAEALDISRETYLAILMDRAYNGPVLVGSPQGGVDIEEVAASNPELIFKEPIDIFEGIKDSQAQRMAENLGFLGPLKNQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKEIFAMDDKSENEPIENEAARYDLKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTSDPKVEAILVNIFGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQNILNNSGLPITSAVDLEDAAKKAVASVGKK",
        "proteome": "UP000694398",
        "gene": "SUCLG2",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004776",
                "name": "succinate-CoA ligase (GDP-forming) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006104",
                "name": "succinyl-CoA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006099",
                "name": "tricarboxylic acid cycle",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "affbd9856777cc0cb3e3046ae941f1e287e103d5",
        "counters": {
            "domain_architectures": 28520,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 2,
                "pfam": 2,
                "hamap": 2,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 2,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28520
        }
    }
}