GET /api/protein/UniProt/A0A8C2VD09/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C2VD09",
        "id": "A0A8C2VD09_CHILA",
        "source_organism": {
            "taxId": "34839",
            "scientificName": "Chinchilla lanigera",
            "fullName": "Chinchilla lanigera (Long-tailed chinchilla)"
        },
        "name": "B-cell antigen receptor complex-associated protein beta chain",
        "description": [
            "Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation"
        ],
        "length": 232,
        "sequence": "MAGLVLCPAAGSWTVLLVLLLSGEPVSPMKSEDMYLNPNGSACSRIWQHPRFVARKRGSVVKMRCHTDSSSLSSIVTWFRKQETDKESQKLSPEQGHILQTHNGTVHTLTIQGIQFEDNGIYFCQQECSGKHPSVFQGCGTELRVMGFSTVAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDEGKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE",
        "proteome": "UP000694398",
        "gene": "CD79B",
        "go_terms": [
            {
                "identifier": "GO:0004888",
                "name": "transmembrane signaling receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007166",
                "name": "cell surface receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b001d6b8d2ec095e8d38fb6609b3cad188542c0c",
        "counters": {
            "domain_architectures": 22380,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "smart": 2,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22380
        }
    }
}