GET /api/protein/UniProt/A0A8C2UMF6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C2UMF6",
"id": "A0A8C2UMF6_CHILA",
"source_organism": {
"taxId": "34839",
"scientificName": "Chinchilla lanigera",
"fullName": "Chinchilla lanigera (Long-tailed chinchilla)"
},
"name": "Endoribonuclease LACTB2",
"description": [
"Endoribonuclease; cleaves preferentially 3' to purine-pyrimidine dinucleotide motifs in single-stranded RNA. The cleavage product contains a free 3' -OH group. Has no activity with double-stranded RNA or DNA. Required for normal mitochondrial function and cell viability"
],
"length": 288,
"sequence": "MAAALPYIERLSCRVVRVLGCNPGPMTLQGTNTYLVGTGSRRILIDTGEPSIPEYISRLKQALVEFNTTIQEILVTHWHIDHSGGIGDICKSINNDTPYCIKKLPRKPPKEEIIENGAQKYVYLEDGDVIRTEGATLKVIYTPGHTDDHMALHLEEENAIFSGDCILGEGTTIFEDLYDYMNSLNLLLKVKADIIYPGHGPVIQNAEAAIQQYISHRNYREEQILTVIRDNFEKSFTKTELVKILYKNVPENLHKMAERNLVLHLKKLEKEGKIFSNTDPDKKWRAVL",
"proteome": "UP000694398",
"gene": "LACTB2",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "858d48b02c6256750224befc0afe732b645980d9",
"counters": {
"domain_architectures": 8601,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"pfam": 2,
"smart": 1,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8601
}
}
}