HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C2TJ73",
"id": "A0A8C2TJ73_COTJA",
"source_organism": {
"taxId": "93934",
"scientificName": "Coturnix japonica",
"fullName": "Coturnix japonica (Japanese quail)"
},
"name": "Clathrin light chain",
"description": [
"Clathrin is the major protein of the polyhedral coat of coated pits and vesicles"
],
"length": 215,
"sequence": "MANMEFFGSQQPPATAGNGAADGAEEDPAAAFLAQQESEIAGIENDEGYGILESGDVPEALQAADGFDSGAVDGVMNGVVYQESNGPTDCYAAISQVDRLQSEPESIRKWREEQKERLEQLDANSRKQEAEWKEKAIKELEEWYARQDEKLQKTKASNRAAEEAFVSDAEDVFPGTEWERVAQLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVR",
"proteome": "UP000694412",
"gene": "CLTA",
"go_terms": [
{
"identifier": "GO:0005198",
"name": "structural molecule activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006886",
"name": "intracellular protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016192",
"name": "vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030130",
"name": "clathrin coat of trans-Golgi network vesicle",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0030132",
"name": "clathrin coat of coated pit",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "960526fd73330e09229907c2c6c9c2da971c1b16",
"counters": {
"domain_architectures": 7600,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"prosite": 2,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7600
}
}
}