GET /api/protein/UniProt/A0A8C2N035/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C2N035",
"id": "A0A8C2N035_CRIGR",
"source_organism": {
"taxId": "10029",
"scientificName": "Cricetulus griseus",
"fullName": "Cricetulus griseus (Chinese hamster)"
},
"name": "Fibrinogen-like protein 1",
"description": [
"Immune suppressive molecule that inhibits antigen-specific T-cell activation by acting as a major ligand of LAG3. Responsible for LAG3 T-cell inhibitory function. Binds LAG3 independently from MHC class II (MHC-II). Secreted by, and promotes growth of, hepatocytes"
],
"length": 293,
"sequence": "ALENVNCLREQERLRAQVHQLETRVKQQQAMIAQLMHEKEVQFLDKGPEDNFIDLGGKRQYADCSEIYNDGFKQSGFYKIKPLQSQASFSVYCDMSDGGGWTVIQRRSDGSENFSRGWNDYENGFGNFVRSNGEYWLGNKNLNLLTMQGDYTLKIDLTDFEKNSRFAQYKHFKVGEKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYNGNCAEEEQSGWWFNRCHSANLNGVYYQGPYTAETDNGVVWYTWHGWWYSLKSVVMKIRPNDFIPNII",
"proteome": null,
"gene": "Fgl1",
"go_terms": [
{
"identifier": "GO:0007596",
"name": "blood coagulation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "773c1c4bd0ba3f4a7d67718754a692a4fd7e8b22",
"counters": {
"domain_architectures": 32923,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 1,
"cdd": 1,
"smart": 1,
"ssf": 1,
"pfam": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 32923
}
}
}