General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C2LX25",
        "id": "A0A8C2LX25_CRIGR",
        "source_organism": {
            "taxId": "10029",
            "scientificName": "Cricetulus griseus",
            "fullName": "Cricetulus griseus (Chinese hamster)"
        },
        "name": "E3 ubiquitin-protein ligase parkin",
        "description": [
            "Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins"
        ],
        "length": 464,
        "sequence": "MIVFVRFNSSHGFPVEVNSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELQNDLTVQSCDLEQQSIVHVVQRPGRKSHETHASGEDKPHDTSGGSVWAPRSLTRVDLSSHILPADSVGLAVILDADSRHGSEAARNPVKPTYNSFYVYCKGPCHRIQPGKLRVQCGTCRQATLTLAQGPSCWEDVLIPNRMSGVCQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITSNSRSITCIACTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEKQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCGFIFCRDCKEAYHEGACDSLFEASGATSQAYRVDERAAEQARWEEASKETIKKTTKPCPRCNVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRACMGDHWFDV",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004842",
                "name": "ubiquitin-protein transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005739",
                "name": "mitochondrion",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005829",
                "name": "cytosol",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cfa6646f4240ab0f2bdc6337a0d171f541c79f66",
        "counters": {
            "domain_architectures": 735,
            "entries": 33,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 6,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "smart": 2,
                "cathgene3d": 3,
                "ssf": 2,
                "pfam": 4,
                "cdd": 5,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 12
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 735
        }
    }
}