General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C1Z9Y0",
        "id": "A0A8C1Z9Y0_CYPCA",
        "source_organism": {
            "taxId": "7962",
            "scientificName": "Cyprinus carpio",
            "fullName": "Cyprinus carpio (Common carp)"
        },
        "name": "Ubiquitin-conjugating enzyme E2 J2",
        "description": [
            "Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD). In cooperation with the GATOR2 complex, catalyzes 'Lys-6'-linked ubiquitination of NPRL2"
        ],
        "length": 259,
        "sequence": "MSNNLNKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYLVRGPEKTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDFTKRQLASQSLAFNIKDKVFCELFPDVVEEIQQKQRMQEELRSRSHALPLPDVVPDGEAHHAQNGHLPLNGHLPPGAAHPPDLQQVNRNHGLLGGALANLFVIVGFAAFAYTVKYVLRSIAQE",
        "proteome": "UP000694427",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "96b2a7d582dea26386e8f982d2fd40014d2b06f9",
        "counters": {
            "domain_architectures": 122920,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 122920
        }
    }
}