HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C1RH31",
"id": "A0A8C1RH31_CYPCA",
"source_organism": {
"taxId": "7962",
"scientificName": "Cyprinus carpio",
"fullName": "Cyprinus carpio (Common carp)"
},
"name": "Oxidized purine nucleoside triphosphate hydrolase",
"description": [
"Oxidized purine nucleoside triphosphate hydrolase which is a prominent sanitizer of the oxidized nucleotide pool. Catalyzes the hydrolysis of 2-oxo-dATP (2-hydroxy-dATP) into 2-oxo-dAMP. Also has a significant hydrolase activity toward 2-oxo-ATP, 8-oxo-dGTP and 8-oxo-dATP. Through the hydrolysis of oxidized purine nucleoside triphosphates, prevents their incorporation into DNA and the subsequent transversions A:T to C:G and G:C to T:A. Also catalyzes the hydrolysis of methylated purine nucleoside triphosphate preventing their integration into DNA. Through this antimutagenic activity protects cells from oxidative stress"
],
"length": 156,
"sequence": "MLTNKLLTLVLVVQPGRVLLGMKKRGFGAGKWNGFGGKVQPGETIEQAARRELLEESGLTVDTLHKIGNIKFEFIGETELLDVHIFRADTYKGEPTESDEMRPQWFDTDKIPFSQMWADDVQWFPLMLQKKKFLGYFKFHGHDVIVEHKLEEVEDV",
"proteome": "UP000694427",
"gene": "nudt1",
"go_terms": [
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008413",
"name": "8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042262",
"name": "DNA protection",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "752b3b6d9807717ea1f029db1420a2538cb188ca",
"counters": {
"domain_architectures": 250306,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 250306
}
}
}