GET /api/protein/UniProt/A0A8C1J0A2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C1J0A2",
        "id": "A0A8C1J0A2_CYPCA",
        "source_organism": {
            "taxId": "7962",
            "scientificName": "Cyprinus carpio",
            "fullName": "Cyprinus carpio (Common carp)"
        },
        "name": "Prohibitin",
        "description": [
            "In the plasma membrane, cooperates with CD86 to mediate CD86-signaling in B lymphocytes that regulates the level of IgG1 produced through the activation of distal signaling intermediates. Upon CD40 engagement, required to activate NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation"
        ],
        "length": 271,
        "sequence": "MAKLFESIGKLGLALAIGGGVVNSALFNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVATQLPRIFTSIGEDYDERVLPSITTEVLKAVVARFDAGELITQRELVSRQVSEDLTERASTFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFVVEKAEQQKQAAIISAEGDSQAALLIANSLAVAGDGLVELRKLEAAEDIAFQLSRSRNVTYLPSGQGTLLQLPQ",
        "proteome": "UP000694427",
        "gene": "phb",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7d45422804c3db3e74d86afe547172aaf2fb3580",
        "counters": {
            "domain_architectures": 99126,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 99126
        }
    }
}