GET /api/protein/UniProt/A0A8C1J0A2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C1J0A2",
"id": "A0A8C1J0A2_CYPCA",
"source_organism": {
"taxId": "7962",
"scientificName": "Cyprinus carpio",
"fullName": "Cyprinus carpio (Common carp)"
},
"name": "Prohibitin",
"description": [
"In the plasma membrane, cooperates with CD86 to mediate CD86-signaling in B lymphocytes that regulates the level of IgG1 produced through the activation of distal signaling intermediates. Upon CD40 engagement, required to activate NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation"
],
"length": 271,
"sequence": "MAKLFESIGKLGLALAIGGGVVNSALFNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVATQLPRIFTSIGEDYDERVLPSITTEVLKAVVARFDAGELITQRELVSRQVSEDLTERASTFGLILDDVSLTHLTFGKEFTEAVEMKQVAQQEAERARFVVEKAEQQKQAAIISAEGDSQAALLIANSLAVAGDGLVELRKLEAAEDIAFQLSRSRNVTYLPSGQGTLLQLPQ",
"proteome": "UP000694427",
"gene": "phb",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7d45422804c3db3e74d86afe547172aaf2fb3580",
"counters": {
"domain_architectures": 99126,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"cdd": 1,
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 99126
}
}
}