GET /api/protein/UniProt/A0A8C1C2L9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C1C2L9",
        "id": "A0A8C1C2L9_CYPCA",
        "source_organism": {
            "taxId": "630221",
            "scientificName": "Cyprinus carpio carpio",
            "fullName": "Cyprinus carpio carpio"
        },
        "name": "Splicing factor, arginine/serine-rich 1",
        "description": [
            "May play a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing"
        ],
        "length": 246,
        "sequence": "MSGGVIRGPAGNNDCRIYVGNLPPDIRTKDVEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGGGRGGGGGGVGAPRGRYGPPSRRSEYRVIVSGLPPSGSWQDLKDHMREAGDVCYADVFRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSQEQD",
        "proteome": "UP001108240",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4059ea5eee6f538d81548f164be416a9befcb0ea",
        "counters": {
            "domain_architectures": 109335,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 2,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 109335
        }
    }
}