GET /api/protein/UniProt/A0A8C0RQT3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C0RQT3",
"id": "A0A8C0RQT3_CANLF",
"source_organism": {
"taxId": "9615",
"scientificName": "Canis lupus familiaris",
"fullName": "Canis lupus familiaris (Dog)"
},
"name": "NADH dehydrogenase [ubiquinone] 1 subunit C2",
"description": [
"Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
],
"length": 120,
"sequence": "MMSGRPGRVPLQLLPDEARSLPPPKLTDPRLAYMGFLGYCSGLLDNAIRRRPVLSAGLHRQLLYVTSFVFIGYYLLRRQDCMYALRDHDMFAYIKSHPEDFPEKDKKTYAELLEEFHPVR",
"proteome": null,
"gene": "NDUFC2",
"go_terms": [
{
"identifier": "GO:0006120",
"name": "mitochondrial electron transport, NADH to ubiquinone",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005743",
"name": "mitochondrial inner membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "61b6703d458d52dabf0173be5d4e731fa970b1e6",
"counters": {
"domain_architectures": 1396,
"entries": 4,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1396
}
}
}