General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C0JTA4",
        "id": "A0A8C0JTA4_CANLU",
        "source_organism": {
            "taxId": "286419",
            "scientificName": "Canis lupus dingo",
            "fullName": "Canis lupus dingo (dingo)"
        },
        "name": "Cytoplasmic tRNA 2-thiolation protein 2",
        "description": [
            "Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with CTU1/ATPBD3 that ligates sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position"
        ],
        "length": 528,
        "sequence": "MCQVGEDYGDPVPEGPPPPRPGRELRCVKCKDGLPVVVIRAGDAFCRDCFRAFYVHKFRAVLGKNRLIFPGEKVLLAWSGGPSSSSMVWQVLEGLSRDSAKRLRFVPGVVYVDEGAACGQSWENRAKTLAEVKLILRSFGFPWHIVALEEVFTLPPSVLRCSAQEPVGTEGTYKVAVDSFLQQQHTVGSSPSPTQQEEQLSQPCTQDPQDPAGPPPAAHIEALSRLFDSVKTLTAKEELLQTLRGHLLLHVARTHGYSKVMTGDSCTRLAIKLMTSLALGRGAFLAWDTGFSDERHGDVVVVRPMREHTLKEVAFYNRLFAVPSIFTPAIDTKAPEKASIHRLMEGFLLRLQAQFPSTVSTVYRTSEKLVKAPRDGCAAGPRCLLCMCSLDVDTADSATAFGAQTQDFSQTQPPTPLAEAGAAPMPCCSAEVGRAQKCCQSTLLCRREDSQVIEQLCYGCRVNMKDVPSLDSLPPYILAEAQFRSQRYELAPMLGECRWVLLGVCMCRAGSQCVASPQALAGYPGVSG",
        "proteome": "UP000694391",
        "gene": "CTU2",
        "go_terms": [
            {
                "identifier": "GO:0000049",
                "name": "tRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0002098",
                "name": "tRNA wobble uridine modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0034227",
                "name": "tRNA thio-modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bd1c1e17b4fee948dbf7b791cb65367063e040b0",
        "counters": {
            "domain_architectures": 3300,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3300
        }
    }
}