General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 107.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C0H6J4",
        "id": "A0A8C0H6J4_CHEAB",
        "source_organism": {
            "taxId": "106734",
            "scientificName": "Chelonoidis abingdonii",
            "fullName": "Chelonoidis abingdonii (Abingdon island giant tortoise)"
        },
        "name": "Endoribonuclease LACTB2",
        "description": [
            "Endoribonuclease; cleaves preferentially 3' to purine-pyrimidine dinucleotide motifs in single-stranded RNA. The cleavage product contains a free 3' -OH group. Has no activity with double-stranded RNA or DNA. Required for normal mitochondrial function and cell viability"
        ],
        "length": 275,
        "sequence": "MVSLLPRIERLSSRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAVPEYIGCLKQALTDFNISIQEILVTHWHHDHTGGISDVCRNIHNGSEYCISKLPRTPHREEIIEGEKLKYSYLKDGDVLKTEGATLRVLYTPGHTDDHMALHLVEENAIFSGDCILGEGTAVFEDLYDYMKSLEMLLQMQADLIYPGHGPVVHDAHAKIQEYISHRNAREQQILNVLQENAGKSFTSMELIKIVYKVIIHNLNFHFNKVNMVCVCVWAFRRLHS",
        "proteome": "UP000694404",
        "gene": "LACTB2",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8e21498551462035f0ee30fd04bcc3fc954926ab",
        "counters": {
            "domain_architectures": 149251,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 149251
        }
    }
}