General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B9T4K3",
        "id": "A0A8B9T4K3_ANAPL",
        "source_organism": {
            "taxId": "8839",
            "scientificName": "Anas platyrhynchos",
            "fullName": "Anas platyrhynchos (Mallard)"
        },
        "name": "Dynein light chain Tctex-type 1",
        "description": [
            "Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Probably binds BUB3 as part of transport cargo. Required for the efficient progression through mitosis"
        ],
        "length": 116,
        "sequence": "MEDFHPHNDEMIFNADEAHNIVKECIESVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGKTYKYIVTCAVMQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL",
        "proteome": null,
        "gene": "DYNLT3",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "80b7725c46393323057c179296f64deb58d1967e",
        "counters": {
            "domain_architectures": 11299,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 11299
        }
    }
}