GET /api/protein/UniProt/A0A8B9SW57/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B9SW57",
"id": "A0A8B9SW57_ANAPL",
"source_organism": {
"taxId": "8839",
"scientificName": "Anas platyrhynchos",
"fullName": "Anas platyrhynchos (Mallard)"
},
"name": "Protein lin-7 homolog",
"description": [
"Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells"
],
"length": 197,
"sequence": "MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQN",
"proteome": null,
"gene": "LIN7C",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0537561ff686f83a70dba21fd89fa564710bee3b",
"counters": {
"domain_architectures": 3408,
"entries": 20,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"profile": 2,
"smart": 2,
"pfam": 2,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3408
}
}
}